Recombinant Proteins

Search Within Results

2,806 – 2,820 of 122,825 results

2,806

Novus Biologicals™ Recombinant Human PPIH Protein

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability

2,807

Promotions Available

R&D Systems™ Recombinant Rat IL-1Rrp2/IL-1R6 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,808

Promotions Available

R&D Systems™ Recombinant Human Hepassocin/FGL1 His-tag Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

2,809

Novus Biologicals™ Recombinant Human Guanine deaminase His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,810

R&D Systems™ Recombinant Human Active PKA C beta Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

2,811

Novus Biologicals™ PCGF5 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

2,812

R&D Systems™ Recombinant Human ACE-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability
Specifications

Accession Number	Q9BYF1
Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	M.W. (Observed): 101-111 kDa, reducing conditions; M.W. (theoretical): 85 kDa
Gene ID (Entrez)	59272
Gene Symbol	ACE2
Structural Form	Recombinant Human ACE-2 is prone to proteolytic cleavage at C-terminus. The predominant form of the purified protein lacks the His tag.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20°C to -70°C as supplied. 3 months, -20°C to -70°C under sterile conditions after opening.
For Use With (Application)	Enzyme Activity
Protein	ACE-2
Source	Mouse myeloma cell line, NS0-derived human ACE-2 protein Gln18-Ser740, with a C-terminal 10-His tag
Recombinant	Recombinant
Name	ACE-2

2,813

Novus Biologicals™ Recombinant Human CENPM His Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Gene Alias	bK250D10.2, C22orf18PANE1MGC861, CENP-Mchromosome 22 open reading frame 18, centromere protein M, ICEN39, Interphase centromere complex protein 39, Pane1, proliferation associated nuclear element 1, Proliferation-associated nuclear element protein 1
Molecular Weight (g/mol)	M.W. Theoretical: 22.1 kDa
Gene ID (Entrez)	79019
Formulation	20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, 30% glycerol, 1mM DTT
Gene Symbol	CENPM
Research Category	DNA replication Transcription Translation and Splicing
Storage Requirements	Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25 mg/ml
For Use With (Application)	SDS-PAGE
Protein	CENPM

2,814

Novus Biologicals™ TEKT4 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

2,815

MilliporeSigma™ Parathyroid Hormone 1-34, Rat, Protein

Pricing & Availability

2,816

Novus Biologicals™ Recombinant Mouse GAPDH His Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability

2,817

Novus Biologicals™ Recombinant Human ARFIP1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	ADP-ribosylation factor interacting protein 1, ADP-ribosylation factor-interacting protein 1, arfaptin 1, arfaptin-1, HSU52521, MGC117369
Common Name	ARFIP1
Molecular Weight (g/mol)	TMW: 44.1kDa
Gene ID (Entrez)	27236
Formulation	Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,818

Promotions Available

Invitrogen™ Human GP2 (aa 35-178) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
pH Range	7.4
Form	Liquid
Common Name	GP2
Gene Symbol	GP2
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
Concentration	0.8 mg/mL
Expression System	E. coli
For Use With (Application)	Neutralization,Control
Name	Human GP2 (aa 35-178) Control Fragment
Accession Number	P55259
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	2310037I18Rik; AV060639; glycoprotein 2; glycoprotein 2 (zymogen granule membrane); glycoprotein 80; GP2; gp80; Pancreatic secretory granule membrane major glycoprotein GP2; pancreatic zymogen granule membrane associated protein GP2; pancreatic zymogen granule membrane protein GP-2; secretory (zymogen) granule membrane glycoprotein GP2; ZAP75; zymogen granule membrane glycoprotein 2
Product Type	Protein
Gene ID (Entrez)	2813
Formulation	PBS, 1M urea with no preservative; pH 7.4
Protein Tag	His-ABP-tag
Recombinant	Recombinant

2,819

Invitrogen™ Human CDK11/cyclin C, GST Tag, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	CDK11/cyclin C
Molecular Weight (g/mol)	84.9-38.0 kDa
KinaseFamily	CDKs and CHKs
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CDK11/cyclin C, GST Tag, His Tag
Purification Method	Purified
Gene Alias	2700084L06Rik; AI845279; AW228747; bA346C16.3; Cdc2l6; CDC2-related protein kinase 6; Cdk11; Cdk19; CDK8-like cyclin-dependent kinase; cell division cycle 2-like 6 (CDK8-like); cell division cycle 2-like protein kinase 6; Cell division protein kinase 19; cyclin dependent kinase 19; cyclin dependent kinase 19 variant 2; cyclin-dependent kinase (CDC2-like) 11; cyclin-dependent kinase 11; Cyclin-dependent kinase 19; death-preventing kinase; KIAA1028; mKIAA1028
Protein Form	Recombinant, Active, Catalytic
Formulation	50mM HEPES with 100mM NaCl, 20% glycerol, 5mM DTT and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	CCNC, CDK19
Sequence	CDK11: 1-502, Cyclin C: 1-283
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	P24863, Q9BWU1
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	23097, 892
Protein Tag	GST-tag, His-tag

2,820

Novus Biologicals™ SHANK2 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

Prev
1
...
186
187
188
189
...
8,189
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human PPIH Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Guanine deaminase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PCGF5 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CENPM His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ TEKT4 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse GAPDH His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ARFIP1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ SHANK2 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PPIH Protein

Novus Biologicals™ Recombinant Human Guanine deaminase His Protein

Novus Biologicals™ PCGF5 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human CENPM His Protein

Novus Biologicals™ TEKT4 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Mouse GAPDH His Protein

Novus Biologicals™ Recombinant Human ARFIP1 His Protein

Novus Biologicals™ SHANK2 Recombinant Protein Antigen